Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 1A
LigandBDBM50388532
Substrate/Competitorn/a
Meas. Tech.ChEMBL_830276
IC50>6000±n/a nM
Citation Nagle AWu TKuhen KGagaring KBorboa RFrancek CChen ZPlouffe DLin XCaldwell CEk JSkolnik SLiu FWang JChang JLi CLiu BHollenbeck TTuntland TIsbell JChuan TAlper PBFischli CBrun RLakshminarayana SBRottmann MDiagana TTWinzeler EAGlynne RTully DCChatterjee AK Imidazolopiperazines: lead optimization of the second-generation antimalarial agents. J Med Chem 55:4244-73 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 1A
Name:Cytochrome P450 1A
Synonyms:CYPIA2 | Cytochrome P450 1A2 | Cytochrome P450 1A2 (CYP1A2)
Type:Enzyme
Mol. Mass.:58310.23
Organism:Homo sapiens (Human)
Description:n/a
Residue:515
Sequence:
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARRFSIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50388532
n/a
NameBDBM50388532
Synonyms:CHEMBL2058833
TypeSmall organic molecule
Emp. Form.C22H23F2N5O
Mol. Mass.411.4477
SMILESCC1(C)N(CCn2c(Nc3ccc(F)cc3)c(nc12)-c1ccc(F)cc1)C(=O)CN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: