Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase ITK/TSK
LigandBDBM50392791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_853168
IC50 72.2±n/a nM
Citation Wang TLamb MLBlock MHDavies AMHan YHoffmann EIoannidis SJosey JALiu ZYLyne PDMacIntyre TMohr PJOmer CASjögren TThress KWang BWang HYu DZhang HJ Discovery of Disubstituted Imidazo[4,5-b]pyridines and Purines as Potent TrkA Inhibitors. ACS Med Chem Lett 3:705-709 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase ITK/TSK
Name:Tyrosine-protein kinase ITK/TSK
Synonyms:ITK | Kinase EMT | T-cell-specific kinase | Tyrosine-protein kinase ITK | Tyrosine-protein kinase ITK (ITK) | Tyrosine-protein kinase Lyk
Type:Protein
Mol. Mass.:71839.20
Organism:Homo sapiens (Human)
Description:n/a
Residue:620
Sequence:
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50392791
n/a
NameBDBM50392791
Synonyms:CHEMBL2151321 | US8486966, 1
TypeSmall organic molecule
Emp. Form.C19H20FN7O
Mol. Mass.381.4068
SMILESCC(C)Oc1cc(n[nH]1)-n1cnc2ccc(N[C@@H](C)c3ccc(F)cn3)nc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: