Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-glutamine gamma-glutamyltransferase 2
LigandBDBM50392906
Substrate/Competitorn/a
Meas. Tech.ChEMBL_853394
IC50 55±n/a nM
Citation Prime MEBrookfield FACourtney SMGaines SMarston RWIchihara OLi MVaidya DWilliams HPedret-Dunn AReed LSchaertl SToledo-Sherman LBeconi MMacdonald DMuņoz-Sanjuan IDominguez CWityak J Irreversible 4-Aminopiperidine Transglutaminase 2 Inhibitors for Huntington's Disease. ACS Med Chem Lett 3:731-735 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-glutamine gamma-glutamyltransferase 2
Name:Protein-glutamine gamma-glutamyltransferase 2
Synonyms:TG(C) | TGC | TGase C | TGase-2 | Tgm2 | Tissue transglutaminase | Transglutaminase C | Transglutaminase-2
Type:PROTEIN
Mol. Mass.:77039.00
Organism:Mus musculus
Description:ChEMBL_841041
Residue:686
Sequence:
MAEELLLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYFEGRGYEASVDSLTFG
AVTGPDPSEEAGTKARFSLSDNVEEGSWSASVLDQQDNVLSLQLCTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLYNAWCPADDVYLDSEEERREYVLTQQGFIYQGSVKFIKSVPW
NFGQFEDGILDTCLMLLDMNPKFLKNRSRDCSRRSSPIYVGRVVSAMVNCNDDQGVLLGR
WDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGELESNKSEMIWNFHCWVESWMTRPDLQPGYEGWQAIDPT
PQEKSEGTYCCGPVSVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSVLKSINRSL
VVGQKISTKSVGRDDREDITHTYKYPEGSPEEREVFTKANHLNKLAEKEETGVAMRIRVG
DSMSMGNDFDVFAHIGNDTSETRECRLLLCARTVSYNGVLGPECGTEDINLTLDPYSENS
IPLRILYEKYSGCLTESNLIKVRGLLIEPAANSYLLAERDLYLENPEIKIRVLGEPKQNR
KLVAEVSLKNPLSDPLYDCIFTVEGAGLTKEQKSVEVSDPVPAGDLVKARVDLFPTDIGL
HKLVVNFQCDKLKSVKGYRNVIIGPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50392906
n/a
NameBDBM50392906
Synonyms:CHEMBL2152204
TypeSmall organic molecule
Emp. Form.C24H29N3O5S
Mol. Mass.471.569
SMILESCOc1ccc(CCNC(=O)c2ccc(cc2)S(=O)(=O)N2CCC(CC2)NC(=O)C=C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: