Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 4 |
---|
Ligand | BDBM50398976 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_875039 (CHEMBL2184357) |
---|
Ki | 0.316±n/a nM |
---|
Citation | Furlotti, G; Alisi, MA; Apicella, C; Capezzone de Joannon, A; Cazzolla, N; Costi, R; Cuzzucoli Crucitti, G; Garrone, B; Iacovo, A; Magarò, G; Mangano, G; Miele, G; Ombrato, R; Pescatori, L; Polenzani, L; Rosi, F; Vitiello, M; Di Santo, R Discovery and pharmacological profile of new 1H-indazole-3-carboxamide and 2H-pyrrolo[3,4-c]quinoline derivatives as selective serotonin 4 receptor ligands. J Med Chem55:9446-66 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 4 |
---|
Name: | 5-hydroxytryptamine receptor 4 |
Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
Type: | Enzyme |
Mol. Mass.: | 43767.54 |
Organism: | Homo sapiens (Human) |
Description: | Q13639 |
Residue: | 388 |
Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
BDBM50398976 |
---|
n/a |
---|
Name | BDBM50398976 |
Synonyms: | CHEMBL2179702 |
Type | Small organic molecule |
Emp. Form. | C20H31N5O3S |
Mol. Mass. | 421.557 |
SMILES | CC(C)n1nc(C(=O)NCC2CCN(CCNS(C)(=O)=O)CC2)c2ccccc12 |
Structure |
|