Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50399644 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_878566 (CHEMBL2188651) |
---|
IC50 | 76±n/a nM |
---|
Citation | Novoa, A; Van Dorpe, S; Wynendaele, E; Spetea, M; Bracke, N; Stalmans, S; Betti, C; Chung, NN; Lemieux, C; Zuegg, J; Cooper, MA; Tourwé, D; De Spiegeleer, B; Schiller, PW; Ballet, S Variation of the net charge, lipophilicity, and side chain flexibility in Dmt(1)-DALDA: Effect on Opioid Activity and Biodistribution. J Med Chem55:9549-61 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50399644 |
---|
n/a |
---|
Name | BDBM50399644 |
Synonyms: | CHEMBL2181194 |
Type | Small organic molecule |
Emp. Form. | C33H49N9O5 |
Mol. Mass. | 651.7995 |
SMILES | [#6]-c1cc(-[#8])cc(-[#6])c1-[#6]-[#6@H](-[#7])-[#6](=O)-[#7]-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6@H]-1-[#6]-c2ccccc2-[#6]-[#7](-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](-[#7])=O)-[#6]-1=O |r| |
Structure |
|