Reaction Details |
| Report a problem with these data |
Target | G-protein coupled bile acid receptor 1 |
---|
Ligand | BDBM50399953 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_877860 (CHEMBL2187734) |
---|
EC50 | 2.8±n/a nM |
---|
Citation | Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J Design, synthesis, and antidiabetic activity of 4-phenoxynicotinamide and 4-phenoxypyrimidine-5-carboxamide derivatives as potent and orally efficacious TGR5 agonists. J Med Chem55:10475-89 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G-protein coupled bile acid receptor 1 |
---|
Name: | G-protein coupled bile acid receptor 1 |
Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 35260.02 |
Organism: | Homo sapiens (Human) |
Description: | CHO cells transiently transfected with hTGR5. |
Residue: | 330 |
Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
BDBM50399953 |
---|
n/a |
---|
Name | BDBM50399953 |
Synonyms: | CHEMBL2181240 |
Type | Small organic molecule |
Emp. Form. | C24H21Cl2N3O2 |
Mol. Mass. | 454.348 |
SMILES | Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CCC3)c3ccccc23)c1 |
Structure |
|