Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50414636
Substrate/Competitorn/a
Meas. Tech.ChEMBL_581589
IC50 2.51±n/a nM
Citation Bethel PAGerhardt SJones EVKenny PWKaroutchi GIMorley ADOldham KRankine NAugustin MKrapp SSimader HSteinbacher S Design of selective Cathepsin inhibitors. Bioorg Med Chem Lett 19:4622-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50414636
n/a
NameBDBM50414636
Synonyms:CHEMBL559880
TypeSmall organic molecule
Emp. Form.C20H17N5O2S
Mol. Mass.391.446
SMILESO=C(NCC#N)C(Cc1cccc(c1)-c1nncs1)NC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: