Reaction Details |
| Report a problem with these data |
Target | G-protein coupled bile acid receptor 1 |
---|
Ligand | BDBM50415391 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_608993 (CHEMBL1073135) |
---|
EC50 | 19.95±n/a nM |
---|
Citation | Budzik, BW; Evans, KA; Wisnoski, DD; Jin, J; Rivero, RA; Szewczyk, GR; Jayawickreme, C; Moncol, DL; Yu, H Synthesis and structure-activity relationships of a series of 3-aryl-4-isoxazolecarboxamides as a new class of TGR5 agonists. Bioorg Med Chem Lett20:1363-7 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G-protein coupled bile acid receptor 1 |
---|
Name: | G-protein coupled bile acid receptor 1 |
Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 35260.02 |
Organism: | Homo sapiens (Human) |
Description: | CHO cells transiently transfected with hTGR5. |
Residue: | 330 |
Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
BDBM50415391 |
---|
n/a |
---|
Name | BDBM50415391 |
Synonyms: | CHEMBL599328 |
Type | Small organic molecule |
Emp. Form. | C19H14ClF3N2O2 |
Mol. Mass. | 394.775 |
SMILES | CN(C(=O)c1c(C)onc1-c1ccccc1Cl)c1ccc(cc1)C(F)(F)F |
Structure |
|