Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 Receptor
LigandBDBM50361015
Substrate/Competitorn/a
Meas. Tech.ChEMBL_613516
Ki 1.55±n/a nM
Citation Smits RAAdami MIstyastono EPZuiderveld OPvan Dam CMde Kanter FJJongejan ACoruzzi GLeurs Rde Esch IJ Synthesis and QSAR of quinazoline sulfonamides as highly potent human histamine H4 receptor inverse agonists. J Med Chem 53:2390-400 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 Receptor
Name:Histamine H4 Receptor
Synonyms:HH4R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44045.07
Organism:Rattus norvegicus (rat)
Description:Cell pellets from SK-N-MC cells transfected with rat H4 receptor were used in binding assay.
Residue:391
Sequence:
MSESNGTDVLPLTAQVPLAFLMSLLAFAITIGNAVVILAFVADRNLRHRSNYFFLNLAIS
DFFVGVISIPLYIPHTLFNWNFGSGICMFWLITDYLLCTASVYSIVLISYDRYQSVSNAV
RYRAQHTGILKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTEECEPGFVTEWYILAIT
AFLEFLLPVSLVVYFSVQIYWSLWKRGSLSRCPSHAGFIATSSRGTGHSRRTGLACRTSL
PGLKEPAASLHSESPRGKSSLLVSLRTHMSGSIIAFKVGSFCRSESPVLHQREHVELLRG
RKLARSLAVLLSAFAICWAPYCLFTIVLSTYRRGERPKSIWYSIAFWLQWFNSLINPFLY
PLCHRRFQKAFWKILCVTKQPAPSQTQSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361015
n/a
NameBDBM50361015
Synonyms:CHEMBL592379
TypeSmall organic molecule
Emp. Form.C21H25ClN6O2S
Mol. Mass.460.98
SMILESCN1CCN(CC1)c1nc(NCCS(=O)(=O)Nc2ccccc2)c2cc(Cl)ccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: