Reaction Details |
| Report a problem with these data |
Target | Orexin/Hypocretin receptor type 1 |
---|
Ligand | BDBM50419132 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_768073 (CHEMBL1833029) |
---|
Ki | 10±n/a nM |
---|
Citation | Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M Discovery process and pharmacological characterization of a novel dual orexin 1 and orexin 2 receptor antagonist useful for treatment of sleep disorders. Bioorg Med Chem Lett21:5562-7 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Orexin/Hypocretin receptor type 1 |
---|
Name: | Orexin/Hypocretin receptor type 1 |
Synonyms: | HCRTR1 | Hypocretin receptor type 1 | OX1R_HUMAN | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r |
Type: | Protein |
Mol. Mass.: | 47554.50 |
Organism: | Homo sapiens (Human) |
Description: | O43613 |
Residue: | 425 |
Sequence: | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
|
|
|
BDBM50419132 |
---|
n/a |
---|
Name | BDBM50419132 |
Synonyms: | CHEMBL1830967 |
Type | Small organic molecule |
Emp. Form. | C27H27NO2 |
Mol. Mass. | 397.5088 |
SMILES | O=C(CC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)c1ccccc1 |r| |
Structure |
|