| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thromboxane A2 receptor |
|---|
| Ligand | BDBM50423023 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_440950 (CHEMBL890041) |
|---|
| IC50 | 2.5±n/a nM |
|---|
| Citation |  Hall, A; Brown, SH; Chessell, IP; Chowdhury, A; Clayton, NM; Coleman, T; Giblin, GM; Hammond, B; Healy, MP; Johnson, MR; Metcalf, A; Michel, AD; Naylor, A; Novelli, R; Spalding, DJ; Sweeting, J 1,5-Biaryl pyrrole derivatives as EP1 receptor antagonists: Structure-activity relationships of 4- and 5-substituted benzoic acid derivatives. Bioorg Med Chem Lett17:732-5 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thromboxane A2 receptor |
|---|
| Name: | Thromboxane A2 receptor |
|---|
| Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
|---|
| Type: | Enyzme |
|---|
| Mol. Mass.: | 37445.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21731 |
|---|
| Residue: | 343 |
|---|
| Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
|---|
| BDBM50423023 |
|---|
| n/a |
|---|
| Name | BDBM50423023 |
|---|
| Synonyms: | CHEMBL427844 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H21BrF2N2O4 |
|---|
| Mol. Mass. | 555.367 |
|---|
| SMILES | CC(=O)Nc1cc(cc(c1)-n1c(C)ccc1-c1cc(Br)ccc1OCc1ccc(F)cc1F)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
