Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMultidrug and toxin extrusion protein 1
LigandBDBM22893
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934320
IC50 8300±n/a nM
Citation Wittwer MBZur AAKhuri NKido YKosaka AZhang XMorrissey KMSali AHuang YGiacomini KM Discovery of potent, selective multidrug and toxin extrusion transporter 1 (MATE1, SLC47A1) inhibitors through prescription drug profiling and computational modeling. J Med Chem 56:781-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Multidrug and toxin extrusion protein 1
Name:Multidrug and toxin extrusion protein 1
Synonyms:MATE-1 | MATE1 | SLC47A1 | Solute carrier family 47 member 1 | hMATE-1
Type:PROTEIN
Mol. Mass.:61928.01
Organism:Homo sapiens (Human)
Description:ChEMBL_934313
Residue:570
Sequence:
MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSA
LVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLN
QGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKL
HQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDH
VGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNV
PRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRK
QLVLRRGLLLLGVFLILLVGILVRFYVRIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22893
n/a
NameBDBM22893
Synonyms:CHEMBL512 | Ranitidine | ZANTAC | dimethyl[(5-{[(2-{[(E)-1-(methylamino)-2-nitroethenyl]amino}ethyl)sulfanyl]methyl}furan-2-yl)methyl]amine
TypeSmall organic molecule
Emp. Form.C13H22N4O3S
Mol. Mass.314.404
SMILESCN\C([CH-][N+]([O-])=O)=[NH+]/CCSCc1ccc(CN(C)C)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: