| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator MgrA |
|---|
| Ligand | BDBM11979 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_944630 (CHEMBL2339937) |
|---|
| IC50 | 8000±n/a nM |
|---|
| Citation |  Gordon, CP; Williams, P; Chan, WC Attenuating Staphylococcus aureus virulence gene regulation: a medicinal chemistry perspective. J Med Chem56:1389-404 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator MgrA |
|---|
| Name: | HTH-type transcriptional regulator MgrA |
|---|
| Synonyms: | HTH-type transcriptional regulator mgrA (MgrA) | MGRA_STAAU | Regulator of autolytic activity | mgr | mgrA |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17090.77 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | P0C1S0 |
|---|
| Residue: | 147 |
|---|
| Sequence: | MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVT
ELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS
SLSQDEVKELNRLLGKVIHAFDETKEK
|
|
|
|---|
| BDBM11979 |
|---|
| n/a |
|---|
| Name | BDBM11979 |
|---|
| Synonyms: | 5-[(3-carboxy-4-hydroxyphenyl)methyl]-2-hydroxybenzoic acid | CHEMBL115145 | MgrA inhibitor, 1 | chemical diversity library compound 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12O6 |
|---|
| Mol. Mass. | 288.2522 |
|---|
| SMILES | OC(=O)c1cc(Cc2ccc(O)c(c2)C(O)=O)ccc1O |
|---|
| Structure | 
|
|---|
Search and Browse
