| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member C3 |
|---|
| Ligand | BDBM50067678 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_948085 (CHEMBL2345591) |
|---|
| IC50 | 300±n/a nM |
|---|
| Citation |  Gazvoda, M; Beranic, N; Turk, S; Burja, B; Kocevar, M; Rižner, TL; Gobec, S; Polanc, S 2,3-diarylpropenoic acids as selective non-steroidal inhibitors of type-5 17ß-hydroxysteroid dehydrogenase (AKR1C3). Eur J Med Chem62:89-97 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member C3 |
|---|
| Name: | Aldo-keto reductase family 1 member C3 |
|---|
| Synonyms: | 17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3) | 3-alpha-HSD type 2 | AK1C3_HUMAN | AKR1C3 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Aldo-keto-reductase family 1 member C3 | DDH1 | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | HSD17B5 | KIAA0119 | PGFS | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36859.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P42330 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
|
|
|
|---|
| BDBM50067678 |
|---|
| n/a |
|---|
| Name | BDBM50067678 |
|---|
| Synonyms: | (6alpha)-17-(Acetyloxy)-6-methylpreg-4-ene-3,20-dione | (6alpha)-6-methyl-3,20-dioxopregn-4-en-17-yl acetate | 17-Acetoxy-6alpha-methylprogesterone | 17alpha-Hydroxy-6alpha-methylprogesterone acetate | 6-alpha-Methyl-17-alpha-acetoxyprogesterone | 6-alpha-Methyl-17-alpha-hydroxyprogesterone acetate | 6alpha-Methyl-17-acetoxy progesterone | 6alpha-Methyl-17alpha-hydroxyprogesterone acetate | 6alpha-Methyl-4-pregnene-3,20-dion-17alpha-ol acetate | MEDROXYPROGESTERONE | Medroxyacetate progesterone | Medroxyprogesterone 17-acetate | Methylacetoxyprogesterone | Metigestrona | US9271961, MPA | medroxyprogesterone acetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H34O4 |
|---|
| Mol. Mass. | 386.5244 |
|---|
| SMILES | C[C@H]1C[C@H]2[C@@H]3CC[C@](OC(C)=O)(C(C)=O)[C@@]3(C)CC[C@@H]2[C@@]2(C)CCC(=O)C=C12 |r,t:28| |
|---|
| Structure | 
|
|---|
Search and Browse
