Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50429828
Substrate/Competitorn/a
Meas. Tech.ChEMBL_949080
EC50>10000±n/a nM
Citation Nettekoven MFingerle JGrether UGrüner SKimbara APüllmann BRogers-Evans MRöver SSchuler FSchulz-Gasch TUllmer C Highly potent and selective cannabinoid receptor 2 agonists: initial hit optimization of an adamantyl hit series identified from high-through-put screening. Bioorg Med Chem Lett 23:1177-81 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor
Type:Enzyme
Mol. Mass.:52842.52
Organism:Mus musculus (Mouse)
Description:P47746
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429828
n/a
NameBDBM50429828
Synonyms:CHEMBL2338184
TypeSmall organic molecule
Emp. Form.C20H22F3NO
Mol. Mass.349.39
SMILESFC(F)(F)c1ccc2CCN(C(=O)C34CC5CC(CC(C5)C3)C4)c2c1 |TLB:11:13:16:20.19.18,THB:14:15:18:22.13.21,14:13:16.15.20:18,21:13:16:20.19.18,21:19:16:22.14.13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: