Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50429833
Substrate/Competitorn/a
Meas. Tech.ChEMBL_949080
EC50>10000±n/a nM
Citation Nettekoven MFingerle JGrether UGrüner SKimbara APüllmann BRogers-Evans MRöver SSchuler FSchulz-Gasch TUllmer C Highly potent and selective cannabinoid receptor 2 agonists: initial hit optimization of an adamantyl hit series identified from high-through-put screening. Bioorg Med Chem Lett 23:1177-81 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor
Type:Enzyme
Mol. Mass.:52842.52
Organism:Mus musculus (Mouse)
Description:P47746
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429833
n/a
NameBDBM50429833
Synonyms:CHEMBL2338178
TypeSmall organic molecule
Emp. Form.C19H23NO
Mol. Mass.281.392
SMILESO=C(N1CCc2ccccc12)C12CC3CC(CC(C3)C1)C2 |TLB:1:11:14:18.17.16,THB:12:13:16:20.11.19,12:11:14.13.18:16,19:11:14:18.17.16,19:17:14:20.12.11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: