Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50429835 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_949086 (CHEMBL2343739) |
---|
EC50 | 900±n/a nM |
---|
Citation | Nettekoven, M; Fingerle, J; Grether, U; Grüner, S; Kimbara, A; Püllmann, B; Rogers-Evans, M; Röver, S; Schuler, F; Schulz-Gasch, T; Ullmer, C Highly potent and selective cannabinoid receptor 2 agonists: initial hit optimization of an adamantyl hit series identified from high-through-put screening. Bioorg Med Chem Lett23:1177-81 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50429835 |
---|
n/a |
---|
Name | BDBM50429835 |
Synonyms: | CHEMBL2338176 |
Type | Small organic molecule |
Emp. Form. | C23H31NO3 |
Mol. Mass. | 369.4971 |
SMILES | COCCOC1CCN(C(=O)C23CC4CC(CC(C4)C2)C3)c2ccccc12 |TLB:9:11:14:18.17.16,THB:12:13:16:20.11.19,12:11:14.13.18:16,19:11:14:18.17.16,19:17:14:20.12.11| |
Structure |
|