| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50429842 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_949087 (CHEMBL2343740) |
|---|
| EC50 | 1200±n/a nM |
|---|
| Citation |  Nettekoven, M; Fingerle, J; Grether, U; Grüner, S; Kimbara, A; Püllmann, B; Rogers-Evans, M; Röver, S; Schuler, F; Schulz-Gasch, T; Ullmer, C Highly potent and selective cannabinoid receptor 2 agonists: initial hit optimization of an adamantyl hit series identified from high-through-put screening. Bioorg Med Chem Lett23:1177-81 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50429842 |
|---|
| n/a |
|---|
| Name | BDBM50429842 |
|---|
| Synonyms: | CHEMBL2338169 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25NO2 |
|---|
| Mol. Mass. | 299.4073 |
|---|
| SMILES | CCOc1ccc(NC(=O)C23CC4CC(CC(C4)C2)C3)cc1 |TLB:8:10:13:17.16.15,THB:11:12:15:19.10.18,11:10:13.12.17:15,18:10:13:17.16.15,18:16:13:19.11.10| |
|---|
| Structure | 
|
|---|
Search and Browse
