| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50430963 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_946852 (CHEMBL2345517) |
|---|
| Ki | 67±n/a nM |
|---|
| Citation |  Desvergne, A; Genin, E; Maréchal, X; Gallastegui, N; Dufau, L; Richy, N; Groll, M; Vidal, J; Reboud-Ravaux, M Dimerized linear mimics of a natural cyclopeptide (TMC-95A) are potent noncovalent inhibitors of the eukaryotic 20S proteasome. J Med Chem56:3367-78 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50430963 |
|---|
| n/a |
|---|
| Name | BDBM50430963 |
|---|
| Synonyms: | CHEMBL2337842 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C66H91N9O12 |
|---|
| Mol. Mass. | 1202.4818 |
|---|
| SMILES | C[C@H](NC(=O)[C@H](Cc1ccc(OCc2ccccc2)cc1)NC(=O)CCCCCNC(=O)CCCCCNC(=O)CCCCCNC(=O)CCCCCNC(=O)OC(C)(C)C)C(=O)N[C@@H](C[C@]1(O)C(=O)Nc2ccccc12)C(=O)NCc1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
