| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50430990 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_947322 (CHEMBL2343628) |
|---|
| IC50 | 1440±n/a nM |
|---|
| Citation |  Kawamura, S; Unno, Y; List, A; Mizuno, A; Tanaka, M; Sasaki, T; Arisawa, M; Asai, A; Groll, M; Shuto, S Potent proteasome inhibitors derived from the unnatural cis-cyclopropane isomer of Belactosin A: synthesis, biological activity, and mode of action. J Med Chem56:3689-700 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50430990 |
|---|
| n/a |
|---|
| Name | BDBM50430990 |
|---|
| Synonyms: | BELACTOSIN A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H27N3O6 |
|---|
| Mol. Mass. | 369.4128 |
|---|
| SMILES | CC[C@H](C)[C@H]1[C@@H](OC1=O)C(=O)N[C@H]1C[C@H]1C[C@H](NC(=O)[C@H](C)N)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
