| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-2 |
|---|
| Ligand | BDBM50430991 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_947320 (CHEMBL2343626) |
|---|
| IC50 | 1320±n/a nM |
|---|
| Citation |  Kawamura, S; Unno, Y; List, A; Mizuno, A; Tanaka, M; Sasaki, T; Arisawa, M; Asai, A; Groll, M; Shuto, S Potent proteasome inhibitors derived from the unnatural cis-cyclopropane isomer of Belactosin A: synthesis, biological activity, and mode of action. J Med Chem56:3689-700 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-2 |
|---|
| Name: | Proteasome subunit beta type-2 |
|---|
| Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22837.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1294233 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
|---|
| BDBM50430991 |
|---|
| n/a |
|---|
| Name | BDBM50430991 |
|---|
| Synonyms: | CHEMBL2338308 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H35N3O5 |
|---|
| Mol. Mass. | 505.6053 |
|---|
| SMILES | CC[C@H](C)[C@H]1[C@@H](OC1=O)C(=O)N[C@H]1C[C@H]1C[C@H](NC(=O)[C@H](C)NC(=O)c1ccc2ccccc2c1)C=C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
