| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50432452 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_953457 (CHEMBL2351068) |
|---|
| Ki | 132±n/a nM |
|---|
| Citation |  Karlström, S; Nordvall, G; Sohn, D; Hettman, A; Turek, D; Åhlin, K; Kers, A; Claesson, M; Slivo, C; Lo-Alfredsson, Y; Petersson, C; Bessidskaia, G; Svensson, PH; Rein, T; Jerning, E; Malmberg, Å; Ahlgen, C; Ray, C; Vares, L; Ivanov, V; Johansson, R Substituted 7-amino-5-thio-thiazolo[4,5-d]pyrimidines as potent and selective antagonists of the fractalkine receptor (CX3CR1). J Med Chem56:3177-90 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM50432452 |
|---|
| n/a |
|---|
| Name | BDBM50432452 |
|---|
| Synonyms: | CHEMBL2349310 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25N5OS2 |
|---|
| Mol. Mass. | 403.565 |
|---|
| SMILES | CC(C)C[C@H](CO)Nc1nc(S[C@@H](C)c2ccccc2)nc2nc(N)sc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
