| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50386790 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_959727 (CHEMBL2383047) |
|---|
| EC50 | 42±n/a nM |
|---|
| Citation |  Lu, H; Fei, H; Yang, F; Zheng, S; Hu, Q; Zhang, L; Yuan, J; Feng, J; Sun, P; Dong, Q Discovery of novel orally bioavailable GPR40 agonists. Bioorg Med Chem Lett23:2920-4 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 31473.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14842 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
|---|
| BDBM50386790 |
|---|
| n/a |
|---|
| Name | BDBM50386790 |
|---|
| Synonyms: | CHEMBL1829174 | CHEMBL2047159 | TAK-875 | US11905230, Example TAK-875 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H32O7S |
|---|
| Mol. Mass. | 524.625 |
|---|
| SMILES | Cc1cc(OCCCS(C)(=O)=O)cc(C)c1-c1cccc(COc2ccc3[C@H](CC(O)=O)COc3c2)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
