| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymase |
|---|
| Ligand | BDBM50434113 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_958460 (CHEMBL2383101) |
|---|
| IC50 | >1000000±n/a nM |
|---|
| Citation |  Taylor, SJ; Padyana, AK; Abeywardane, A; Liang, S; Hao, MH; De Lombaert, S; Proudfoot, J; Farmer, BS; Li, X; Collins, B; Martin, L; Albaugh, DR; Hill-Drzewi, M; Pullen, SS; Takahashi, H Discovery of potent, selective chymase inhibitors via fragment linking strategies. J Med Chem56:4465-81 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymase |
|---|
| Name: | Chymase |
|---|
| Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27340.12 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 247 |
|---|
| Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
|---|
| BDBM50434113 |
|---|
| n/a |
|---|
| Name | BDBM50434113 |
|---|
| Synonyms: | CHEMBL2381486 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H6ClNO |
|---|
| Mol. Mass. | 167.592 |
|---|
| SMILES | Clc1ccc2CNC(=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
