Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PLK3
LigandBDBM50437854
Substrate/Competitorn/a
Meas. Tech.ChEMBL_973990
IC50>10000±n/a nM
Citation Laufer RForrest BLi SWLiu YSampson PEdwards LLang YAwrey DEMao GPlotnikova OLeung GHodgson RBeletskaya IMason JMLuo XWei XYao YFeher MBan FKiarash RGreen EMak TWPan GPauls HW The discovery of PLK4 inhibitors: (E)-3-((1H-Indazol-6-yl)methylene)indolin-2-ones as novel antiproliferative agents. J Med Chem 56:6069-87 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PLK3
Name:Serine/threonine-protein kinase PLK3
Synonyms:Cytokine-inducible serine/threonine-protein kinase | FGF-inducible kinase | Polo-Like Kinase 3 | Proliferation-related kinase | Serine/threonine-protein kinase PLK3
Type:Serine/threonine-protein kinase
Mol. Mass.:71655.17
Organism:Homo sapiens (Human)
Description:Enzyme assays were using PLK3 purified from baculovirus-infected Trichoplusia ni cells expressing full-length PLK3.
Residue:646
Sequence:
MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGR
TYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKN
HAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
SSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYME
QHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50437854
n/a
NameBDBM50437854
Synonyms:CHEMBL2407918
TypeSmall organic molecule
Emp. Form.C18H14N4O2
Mol. Mass.318.3294
SMILESCC(=O)Nc1ccc2NC(=O)\C(=C\c3ccc4cn[nH]c4c3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: