Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
---|
Ligand | BDBM8726 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1276826 (CHEMBL3089494) |
---|
IC50 | 200±n/a nM |
---|
Citation | Shirude, PS; Madhavapeddi, P; Naik, M; Murugan, K; Shinde, V; Nandishaiah, R; Bhat, J; Kumar, A; Hameed, S; Holdgate, G; Davies, G; McMiken, H; Hegde, N; Ambady, A; Venkatraman, J; Panda, M; Bandodkar, B; Sambandamurthy, VK; Read, JA Methyl-thiazoles: a novel mode of inhibition with the potential to develop novel inhibitors targeting InhA in Mycobacterium tuberculosis. J Med Chem56:8533-42 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
Synonyms: | Enoyl-ACP Reductase (InhA) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-[acyl-carrier-protein] reductase [NADH] | INHA_MYCTU | NADH-dependent enoyl-ACP reductase | inhA |
Type: | Enzyme |
Mol. Mass.: | 28526.00 |
Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Description: | P9WGR1 |
Residue: | 269 |
Sequence: | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
|
|
BDBM8726 |
---|
n/a |
---|
Name | BDBM8726 |
Synonyms: | 5-chloro-2-(2,4-dichlorophenoxy)phenol | CHEMBL849 | TCL | Triclosan | US20230414581, Compound 35 |
Type | Small organic molecule |
Emp. Form. | C12H7Cl3O2 |
Mol. Mass. | 289.542 |
SMILES | Oc1cc(Cl)ccc1Oc1ccc(Cl)cc1Cl |
Structure |
|