| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50367443 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201908 (CHEMBL873466) |
|---|
| IC50 | 2050±n/a nM |
|---|
| Citation |  Seri-Levy, A; West, S; Richards, WG Molecular similarity, quantitative chirality, and QSAR for chiral drugs. J Med Chem37:1727-32 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50367443 |
|---|
| n/a |
|---|
| Name | BDBM50367443 |
|---|
| Synonyms: | CHEMBL45778 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H23NO |
|---|
| Mol. Mass. | 233.3492 |
|---|
| SMILES | CCCCN1CCC[C@@H](C1)c1cccc(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
