Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50011497 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1352881 (CHEMBL3269398) |
---|
Ki | 1.1±n/a nM |
---|
Citation | Castellano, S; Taliani, S; Viviano, M; Milite, C; Da Pozzo, E; Costa, B; Barresi, E; Bruno, A; Cosconati, S; Marinelli, L; Greco, G; Novellino, E; Sbardella, G; Da Settimo, F; Martini, C Structure-activity relationship refinement and further assessment of 4-phenylquinazoline-2-carboxamide translocator protein ligands as antiproliferative agents in human glioblastoma tumors. J Med Chem57:2413-28 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50011497 |
---|
n/a |
---|
Name | BDBM50011497 |
Synonyms: | CHEMBL3261907 |
Type | Small organic molecule |
Emp. Form. | C23H18FN3O |
Mol. Mass. | 371.4069 |
SMILES | CN(Cc1ccccc1)C(=O)c1nc(-c2ccccc2F)c2ccccc2n1 |
Structure |
|