Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 12 |
---|
Ligand | BDBM50019020 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1361093 (CHEMBL3291547) |
---|
IC50 | 42±n/a nM |
---|
Citation | Giordanetto, F; Bach, P; Zetterberg, F; Antonsson, T; Bylund, R; Johansson, J; Sellén, M; Brown, D; Hideståhl, L; Berntsson, P; Hovdal, D; Zachrisson, H; Björkman, JA; van Giezen, JJ Optimization of ketone-based P2Y(12) receptor antagonists as antithrombotic agents: pharmacodynamics and receptor kinetics considerations. Bioorg Med Chem Lett24:2963-8 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 12 |
---|
Name: | P2Y purinoceptor 12 |
Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
Type: | Enzyme |
Mol. Mass.: | 39458.48 |
Organism: | Homo sapiens (Human) |
Description: | Q9H244 |
Residue: | 342 |
Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
BDBM50019020 |
---|
n/a |
---|
Name | BDBM50019020 |
Synonyms: | CHEMBL3288126 |
Type | Small organic molecule |
Emp. Form. | C24H26F2N4O4S |
Mol. Mass. | 504.549 |
SMILES | CCCC(=O)c1cc(C#N)c(nc1C)N1CCC(CC1)C(=O)NS(=O)(=O)Cc1ccc(F)cc1F |
Structure |
|