Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Lck
LigandBDBM50020310
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365416
Ki 2000±n/a nM
Citation Zhang LZheng QYang YZhou HGong XZhao SFan C Synthesis and in vivo SAR study of indolin-2-one-based multi-targeted inhibitors as potential anticancer agents. Eur J Med Chem 82:139-51 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Lck
Name:Tyrosine-protein kinase Lck
Synonyms:2.7.10.2 | LCK | LSK | Leukocyte C-terminal Src kinase | Lymphocyte cell-specific protein-tyrosine kinase | Lymphocyte-specific protein tyrosine kinase | P56-LCK | Protein YT16 | Proto-oncogene Lck | Proto-oncogene tyrosine-protein kinase LCK | SRC | T cell-specific protein-tyrosine kinase
Type:n/a
Mol. Mass.:57987.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:509
Sequence:
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020310
n/a
NameBDBM50020310
Synonyms:CHEMBL3288854
TypeSmall organic molecule
Emp. Form.C23H28FN5O2
Mol. Mass.425.4991
SMILESCN1CCN(CCC(=O)Nc2c(C)[nH]c(\C=C3/C(=O)Nc4ccc(F)cc34)c2C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: