Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 3
LigandBDBM50021074
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365876
EC50 0.516000±n/a nM
Citation Li DWu ZYu YBall RGGuo LSherer EHe SHong QLai ZQi HTruong QYang DXChicchi GGTsao KLTrusca DTrujillo MPachanski MEiermann GJHoward ADZhou YPZhang BBNargund RPHagmann WK Diamine Derivatives as Novel Small-Molecule, Potent, and Subtype-Selective Somatostatin SST3 Receptor Agonists. ACS Med Chem Lett 5:690-5 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 3
Name:Somatostatin receptor type 3
Synonyms:SOMATOSTATIN SST3 | SS-3-R | SS3-R | SS3R | SSR-28 | SSTR3 | Somatostatin receptor type 3 (SSTR3)
Type:Protein
Mol. Mass.:45855.97
Organism:Homo sapiens (Human)
Description:P32745
Residue:418
Sequence:
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM
AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV
FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV
WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE
SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021074
n/a
NameBDBM50021074
Synonyms:CHEMBL3287628
TypeSmall organic molecule
Emp. Form.C24H24Cl2N2O
Mol. Mass.427.366
SMILESClc1ccc(CN[C@H]2CCCC[C@H]2NC(=O)c2ccc3ccccc3c2)cc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: