Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50021351 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1366689 (CHEMBL3296840) |
---|
Ki | 85±n/a nM |
---|
Citation | Troiano, V; Scarbaci, K; Ettari, R; Micale, N; Cerchia, C; Pinto, A; Schirmeister, T; Novellino, E; Grasso, S; Lavecchia, A; Zappalą, M Optimization of peptidomimetic boronates bearing a P3 bicyclic scaffold as proteasome inhibitors. Eur J Med Chem83:1-14 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50021351 |
---|
n/a |
---|
Name | BDBM50021351 |
Synonyms: | CHEMBL3287942 |
Type | Small organic molecule |
Emp. Form. | C19H27BN2O6 |
Mol. Mass. | 390.238 |
SMILES | COc1cc2ccn(CCC(=O)N[C@@H](CC(C)C)B(O)O)c(=O)c2cc1OC |r| |
Structure |
|