Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50021353 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1366692 (CHEMBL3296843) |
---|
Ki | 23700±n/a nM |
---|
Citation | Troiano, V; Scarbaci, K; Ettari, R; Micale, N; Cerchia, C; Pinto, A; Schirmeister, T; Novellino, E; Grasso, S; Lavecchia, A; Zappalą, M Optimization of peptidomimetic boronates bearing a P3 bicyclic scaffold as proteasome inhibitors. Eur J Med Chem83:1-14 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50021353 |
---|
n/a |
---|
Name | BDBM50021353 |
Synonyms: | CHEMBL3287944 |
Type | Small organic molecule |
Emp. Form. | C17H22BBrN2O4 |
Mol. Mass. | 409.083 |
SMILES | CC(C)C[C@H](NC(=O)CCn1ccc2ccc(Br)cc2c1=O)B(O)O |r| |
Structure |
|