| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50027711 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1435391 (CHEMBL3383465) |
|---|
| IC50 | 3370±n/a nM |
|---|
| Citation |  Liu, Z; Chen, W; Zhan, P; De Clercq, E; Pannecouque, C; Liu, X Design, synthesis and anti-HIV evaluation of novel diarylnicotinamide derivatives (DANAs) targeting the entrance channel of the NNRTI binding pocket through structure-guided molecular hybridization. Eur J Med Chem87:52-62 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50027711 |
|---|
| n/a |
|---|
| Name | BDBM50027711 |
|---|
| Synonyms: | CHEMBL3338525 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H21N5O2 |
|---|
| Mol. Mass. | 423.4665 |
|---|
| SMILES | Cc1cc(cc(C)c1Oc1cc(Nc2ccc(cc2)C#N)ncc1C(=O)NC1CC1)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
