Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 11
LigandBDBM50032274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1440130
Ki 1500±n/a nM
Citation Maolanon ARVilladsen JSChristensen NJHoeck CFriis THarris PGotfredsen CHFristrup POlsen CA Methyl effect in azumamides provides insight into histone deacetylase inhibition by macrocycles. J Med Chem 57:9644-57 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 11
Name:Histone deacetylase 11
Synonyms:HD11 | Human HDAC11
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:39187.66
Organism:Homo sapiens (Human)
Description:Recombinant HDAC11 was expressed in Sf9 cells.
Residue:347
Sequence:
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSML
VEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
NIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032274
n/a
NameBDBM50032274
Synonyms:CHEMBL3352996
TypeSmall organic molecule
Emp. Form.C26H36N4O6
Mol. Mass.500.5872
SMILESCC(C)[C@H]1NC(=O)C[C@@H](C\C=C/CCC(O)=O)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@@H](C)NC1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: