Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50034992 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1431831 (CHEMBL3385688) |
---|
IC50 | 119±n/a nM |
---|
Citation | Alonso, JA; Andrés, M; Bravo, M; Calbet, M; Eastwood, PR; Eichhorn, P; Esteve, C; Ferrer, M; Gómez, E; González, J; Mir, M; Moreno, I; Petit, S; Roberts, RS; Sevilla, S; Vidal, B; Vidal, L; Vilaseca, P; Zanuy, M Structure-activity relationships (SAR) and structure-kinetic relationships (SKR) of bicyclic heteroaromatic acetic acids as potent CRTh2 antagonists II: lead optimization. Bioorg Med Chem Lett24:5123-6 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50034992 |
---|
n/a |
---|
Name | BDBM50034992 |
Synonyms: | CHEMBL3343115 |
Type | Small organic molecule |
Emp. Form. | C25H25F3N2O3 |
Mol. Mass. | 458.4728 |
SMILES | CCN(Cc1cc(ccc1-n1cc(CC(O)=O)c2ccc(C)cc12)C(F)(F)F)C(=O)C1CC1 |
Structure |
|