Reaction Details |
| Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50042003 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1443856 (CHEMBL3373530) |
---|
IC50 | 5.0±n/a nM |
---|
Citation | Naidu, BN; Sorenson, ME; Patel, M; Ueda, Y; Banville, J; Beaulieu, F; Bollini, S; Dicker, IB; Higley, H; Lin, Z; Pajor, L; Parker, DD; Terry, BJ; Zheng, M; Martel, A; Meanwell, NA; Krystal, M; Walker, MA Synthesis and evaluation of C2-carbon-linked heterocyclic-5-hydroxy-6-oxo-dihydropyrimidine-4-carboxamides as HIV-1 integrase inhibitors. Bioorg Med Chem Lett25:717-20 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50042003 |
---|
n/a |
---|
Name | BDBM50042003 |
Synonyms: | CHEMBL3360115 |
Type | Small organic molecule |
Emp. Form. | C18H20FN3O3S |
Mol. Mass. | 377.433 |
SMILES | Cn1c(nc(C(=O)NCc2ccc(F)cc2)c(O)c1=O)C1(C)CCCS1 |
Structure |
|