Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50042850
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1444645
IC50>100000±n/a nM
Citation Grosche PSirockin FMac Sweeney ARamage PErbel PMelkko SBernardi AHughes NEllis DCombrink KDJarousse NAltmann E Structure-based design and optimization of potent inhibitors of the adenoviral protease. Bioorg Med Chem Lett 25:438-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042850
n/a
NameBDBM50042850
Synonyms:CHEMBL3354492
TypeSmall organic molecule
Emp. Form.C22H21Cl2N3O4
Mol. Mass.462.326
SMILESCOc1ccc(cc1C(=O)C(C)(C)c1cc(Cl)cc(Cl)c1)C(=O)NCC(=O)NCC#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: