| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Taste receptor type 2 member 4 |
|---|
| Ligand | BDBM50044849 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1456201 (CHEMBL3361956) |
|---|
| EC50 | <10000±n/a nM |
|---|
| Citation |  Sparks, SM; Chen, G; Collins, JL; Danger, D; Dock, ST; Jayawickreme, C; Jenkinson, S; Laudeman, C; Leesnitzer, MA; Liang, X; Maloney, P; McCoy, DC; Moncol, D; Rash, V; Rimele, T; Vulimiri, P; Way, JM; Ross, S Identification of diarylsulfonamides as agonists of the free fatty acid receptor 4 (FFA4/GPR120). Bioorg Med Chem Lett24:3100-3 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Taste receptor type 2 member 4 |
|---|
| Name: | Taste receptor type 2 member 4 |
|---|
| Synonyms: | T2R4 | TA2R4_HUMAN | TAS2R4 | Taste receptor type 2 member 4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33861.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_109436 |
|---|
| Residue: | 299 |
|---|
| Sequence: | MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLG
LFLVNTIYFVSSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLL
LKRNISPKIPRLLLACVLISAFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVS
LVLSSSLQFIINVTSASLLIHSLRRHIQKMQKNATGFWNPQTEAHVGAMKLMVYFLILYI
PYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLIIITHPKLKTTAKKILCFKK
|
|
|
|---|
| BDBM50044849 |
|---|
| n/a |
|---|
| Name | BDBM50044849 |
|---|
| Synonyms: | CHEMBL3311308 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19NO3S |
|---|
| Mol. Mass. | 305.392 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)Nc1c(C)cc(C)cc1C |
|---|
| Structure | 
|
|---|
Search and Browse
