Reaction Details |
| Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50044849 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1454431 (CHEMBL3365227) |
---|
EC50 | <31623±n/a nM |
---|
Citation | Sparks, SM; Chen, G; Collins, JL; Danger, D; Dock, ST; Jayawickreme, C; Jenkinson, S; Laudeman, C; Leesnitzer, MA; Liang, X; Maloney, P; McCoy, DC; Moncol, D; Rash, V; Rimele, T; Vulimiri, P; Way, JM; Ross, S Identification of diarylsulfonamides as agonists of the free fatty acid receptor 4 (FFA4/GPR120). Bioorg Med Chem Lett24:3100-3 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1_MOUSE | Ffar1 | Gpr40 |
Type: | PROTEIN |
Mol. Mass.: | 31818.80 |
Organism: | Mus musculus |
Description: | ChEMBL_1454431 |
Residue: | 300 |
Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP
LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
|
|
|
BDBM50044849 |
---|
n/a |
---|
Name | BDBM50044849 |
Synonyms: | CHEMBL3311308 |
Type | Small organic molecule |
Emp. Form. | C16H19NO3S |
Mol. Mass. | 305.392 |
SMILES | COc1ccc(cc1)S(=O)(=O)Nc1c(C)cc(C)cc1C |
Structure |
|