| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled estrogen receptor 1 |
|---|
| Ligand | BDBM50044849 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1455302 (CHEMBL3362666) |
|---|
| EC50 | <50119±n/a nM |
|---|
| Citation |  Sparks, SM; Chen, G; Collins, JL; Danger, D; Dock, ST; Jayawickreme, C; Jenkinson, S; Laudeman, C; Leesnitzer, MA; Liang, X; Maloney, P; McCoy, DC; Moncol, D; Rash, V; Rimele, T; Vulimiri, P; Way, JM; Ross, S Identification of diarylsulfonamides as agonists of the free fatty acid receptor 4 (FFA4/GPR120). Bioorg Med Chem Lett24:3100-3 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled estrogen receptor 1 |
|---|
| Name: | G-protein coupled estrogen receptor 1 |
|---|
| Synonyms: | Chemoattractant receptor-like 2 | Cmkrl2 | Cmkrl2 | G protein-coupled estrogen receptor 1 | G-protein coupled estrogen receptor 1 | G-protein coupled receptor 30 | G-protein coupled receptor 41 | GPER1_RAT | Gper | Gper1 | Gpr30 | Gpr41 | Membrane estrogen receptor | mER |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 42266.72 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_109432 |
|---|
| Residue: | 375 |
|---|
| Sequence: | MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALF
LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLD
EQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGL
IWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRA
LIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRH
AYPLTGHIVNLAAFSNSCLSPLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVI
PDSTEQSDVKFSSAV
|
|
|
|---|
| BDBM50044849 |
|---|
| n/a |
|---|
| Name | BDBM50044849 |
|---|
| Synonyms: | CHEMBL3311308 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19NO3S |
|---|
| Mol. Mass. | 305.392 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)Nc1c(C)cc(C)cc1C |
|---|
| Structure | 
|
|---|
Search and Browse
