| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50045325 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1458115 (CHEMBL3367912) |
|---|
| EC50 | 7.0±n/a nM |
|---|
| Citation |  Tsuji, T; Suzuki, K; Nakamura, T; Goto, T; Sekiguchi, Y; Ikeda, T; Fukuda, T; Takemoto, T; Mizuno, Y; Kimura, T; Kawase, Y; Nara, F; Kagari, T; Shimozato, T; Yahara, C; Inaba, S; Honda, T; Izumi, T; Tamura, M; Nishi, T Synthesis and SAR studies of benzyl ether derivatives as potent orally active S1P1 agonists. Bioorg Med Chem22:4246-56 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42836.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21453 |
|---|
| Residue: | 382 |
|---|
| Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50045325 |
|---|
| n/a |
|---|
| Name | BDBM50045325 |
|---|
| Synonyms: | CHEMBL3311106 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H30NO6P |
|---|
| Mol. Mass. | 435.4505 |
|---|
| SMILES | Cc1ccc(CCCC(=O)c2ccc(COC[C@@](C)(N)COP(O)(O)=O)cc2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
