Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50240520 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1467648 (CHEMBL3411010) |
---|
IC50 | 530±n/a nM |
---|
Citation | Spencer, ES; Dale, EJ; Gommans, AL; Rutledge, MT; Vo, CT; Nakatani, Y; Gamble, AB; Smith, RA; Wilbanks, SM; Hampton, MB; Tyndall, JD Multiple binding modes of isothiocyanates that inhibit macrophage migration inhibitory factor. Eur J Med Chem93:501-10 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50240520 |
---|
n/a |
---|
Name | BDBM50240520 |
Synonyms: | (isothiocyanatomethyl)benzene | BITC, 17 | Benzylsenfoel | CHEMBL55285 | Isothiocyanic acid, benzyl ester | alpha-isothiocyanatotoluene | benzyl isothiocyanate |
Type | Small organic molecule |
Emp. Form. | C8H7NS |
Mol. Mass. | 149.213 |
SMILES | S=C=NCc1ccccc1 |
Structure |
|