| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50073659 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1467649 (CHEMBL3411011) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Spencer, ES; Dale, EJ; Gommans, AL; Rutledge, MT; Vo, CT; Nakatani, Y; Gamble, AB; Smith, RA; Wilbanks, SM; Hampton, MB; Tyndall, JD Multiple binding modes of isothiocyanates that inhibit macrophage migration inhibitory factor. Eur J Med Chem93:501-10 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50073659 |
|---|
| n/a |
|---|
| Name | BDBM50073659 |
|---|
| Synonyms: | CHEMBL3409220 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H9NO2S |
|---|
| Mol. Mass. | 195.238 |
|---|
| SMILES | Oc1ccc(CCN=C=S)cc1O |
|---|
| Structure | 
|
|---|
Search and Browse
