Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50084013 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1475050 (CHEMBL3424652) |
---|
IC50 | 17190±n/a nM |
---|
Citation | Xu, K; Wang, K; Yang, Y; Yan, DA; Huang, L; Chen, CH; Xiao, Z Discovery of novel non-covalent inhibitors selective to the฿5-subunit of the human 20S proteasome. Eur J Med Chem98:61-8 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50084013 |
---|
n/a |
---|
Name | BDBM50084013 |
Synonyms: | CHEMBL3423346 |
Type | Small organic molecule |
Emp. Form. | C25H32N4O6 |
Mol. Mass. | 484.5448 |
SMILES | CC(C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)Cc1cccc(Oc2ccccc2)c1)C(=O)NCCO |r| |
Structure |
|