| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D Synthase |
|---|
| Ligand | BDBM50084153 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1477159 |
|---|
| IC50 | 210±n/a nM |
|---|
| Citation |  Edfeldt F; Evenäs J; Lepistö M; Ward A; Petersen J; Wissler L; Rohman M; Sivars U; Svensson K; Perry M; Feierberg I; Zhou XH; Hansson T; Narjes F Identification of indole inhibitors of human hematopoietic prostaglandin D2 synthase (hH-PGDS). Bioorg Med Chem Lett 25:2496-500 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D Synthase |
|---|
| Name: | Prostaglandin D Synthase |
|---|
| Synonyms: | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | Prostaglandin D |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23341.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
|---|
| BDBM50084153 |
|---|
| n/a |
|---|
| Name | BDBM50084153 |
|---|
| Synonyms: | CHEMBL3425948 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22F3N3O2 |
|---|
| Mol. Mass. | 393.4028 |
|---|
| SMILES | COc1cccc(c1)-c1ccc(cn1)C(=O)NC1CCN(CC(F)(F)F)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
