Reaction Details |
| Report a problem with these data |
Target | Similar to alpha-tubulin isoform 1 |
---|
Ligand | BDBM50084938 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1476789 (CHEMBL3429443) |
---|
IC50 | 1100±n/a nM |
---|
Citation | Romagnoli, R; Baraldi, PG; Salvador, MK; Prencipe, F; Lopez-Cara, C; Schiaffino Ortega, S; Brancale, A; Hamel, E; Castagliuolo, I; Mitola, S; Ronca, R; Bortolozzi, R; Porcù, E; Basso, G; Viola, G Design, synthesis, in vitro, and in vivo anticancer and antiangiogenic activity of novel 3-arylaminobenzofuran derivatives targeting the colchicine site on tubulin. J Med Chem58:3209-22 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Similar to alpha-tubulin isoform 1 |
---|
Name: | Similar to alpha-tubulin isoform 1 |
Synonyms: | Similar to alpha-tubulin isoform 1 |
Type: | PROTEIN |
Mol. Mass.: | 10383.05 |
Organism: | Bos taurus |
Description: | ChEMBL_104716 |
Residue: | 99 |
Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
BDBM50084938 |
---|
n/a |
---|
Name | BDBM50084938 |
Synonyms: | CHEMBL3427378 |
Type | Small organic molecule |
Emp. Form. | C20H21NO7 |
Mol. Mass. | 387.3832 |
SMILES | COC(=O)c1oc2cc(OC)ccc2c1Nc1cc(OC)c(OC)c(OC)c1 |
Structure |
|