| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM50092470 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1500716 (CHEMBL3588066) |
|---|
| IC50 | >300000±n/a nM |
|---|
| Citation |  Winneroski, LL; Schiffler, MA; Erickson, JA; May, PC; Monk, SA; Timm, DE; Audia, JE; Beck, JP; Boggs, LN; Borders, AR; Boyer, RD; Brier, RA; Hudziak, KJ; Klimkowski, VJ; Garcia Losada, P; Mathes, BM; Stout, SL; Watson, BM; Mergott, DJ Preparation and biological evaluation of conformationally constrained BACE1 inhibitors. Bioorg Med Chem23:3260-8 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM50092470 |
|---|
| n/a |
|---|
| Name | BDBM50092470 |
|---|
| Synonyms: | CHEMBL3586131 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H21Cl2N3O2S |
|---|
| Mol. Mass. | 402.339 |
|---|
| SMILES | Cl.[H][C@@]12COC[C@]3(CC[C@@H](C[C@]13[H])NC(=O)c1cccc(Cl)c1)N=C(N)S2 |r,t:25| |
|---|
| Structure | 
|
|---|
Search and Browse
