| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trace amine-associated receptor 1 |
|---|
| Ligand | BDBM10758 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1499376 (CHEMBL3583705) |
|---|
| EC50 | 138±n/a nM |
|---|
| Citation |  Chiellini, G; Nesi, G; Digiacomo, M; Malvasi, R; Espinoza, S; Sabatini, M; Frascarelli, S; Laurino, A; Cichero, E; Macchia, M; Gainetdinov, RR; Fossa, P; Raimondi, L; Zucchi, R; Rapposelli, S Design, Synthesis, and Evaluation of Thyronamine Analogues as Novel Potent Mouse Trace Amine Associated Receptor 1 (mTAAR1) Agonists. J Med Chem58:5096-107 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Trace amine-associated receptor 1 |
|---|
| Name: | Trace amine-associated receptor 1 |
|---|
| Synonyms: | TAAR1_MOUSE | Ta1 | Taar1 | Tar1 | Trace amine receptor 1 (TARR1) | Trace amine-associated receptor 1 (TAAR1) | Trace amine-associated receptor1 | Trar1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37635.41 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | Q923Y8 |
|---|
| Residue: | 332 |
|---|
| Sequence: | MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWL
LHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDR
YCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGG
CSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQ
SKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMV
YAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL
|
|
|
|---|
| BDBM10758 |
|---|
| n/a |
|---|
| Name | BDBM10758 |
|---|
| Synonyms: | 14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H11N |
|---|
| Mol. Mass. | 121.1796 |
|---|
| SMILES | NCCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
