Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrace amine-associated receptor 1 (TAAR1)
LigandBDBM10758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1499376
EC50 138±n/a nM
Citation Chiellini GNesi GDigiacomo MMalvasi REspinoza SSabatini MFrascarelli SLaurino ACichero EMacchia MGainetdinov RRFossa PRaimondi LZucchi RRapposelli S Design, Synthesis, and Evaluation of Thyronamine Analogues as Novel Potent Mouse Trace Amine Associated Receptor 1 (mTAAR1) Agonists. J Med Chem 58:5096-107 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trace amine-associated receptor 1 (TAAR1)
Name:Trace amine-associated receptor 1 (TAAR1)
Synonyms:Trace amine receptor 1 (TARR1) | Trace amine-associated receptor1
Type:Protein
Mol. Mass.:37635.41
Organism:Mus musculus (Mouse)
Description:Q923Y8
Residue:332
Sequence:
MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWL
LHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDR
YCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGG
CSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQ
SKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMV
YAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10758
n/a
NameBDBM10758
Synonyms:14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine
TypeSmall organic molecule
Emp. Form.C8H11N
Mol. Mass.121.1796
SMILESNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: