Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2J2
LigandBDBM31772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1487322
IC50 640±n/a nM
Citation Lee CAJones JPKatayama JKaspera RJiang YFreiwald SSmith EWalker GSTotah RA Identifying a selective substrate and inhibitor pair for the evaluation of CYP2J2 activity. Drug Metab Dispos 40:943-51 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2J2
Name:Cytochrome P450 2J2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:57623.04
Organism:Homo sapiens (Human)
Description:P51589
Residue:502
Sequence:
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31772
n/a
NameBDBM31772
Synonyms:1-[2-(2,4-dichlorobenzyl)oxy-2-(2,4-dichlorophenyl)ethyl]imidazole;nitric acid | Brentan | CHEMBL91 | Dactarin | Miconazole | US9138393, Miconazole Nitrate | US9144538, Miconazole Nitrate | cid_4189
TypeSmall organic molecule
Emp. Form.C18H14Cl4N2O
Mol. Mass.416.129
SMILESClc1ccc(COC(Cn2ccnc2)c2ccc(Cl)cc2Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: